PDB entry 6fxq

View 6fxq on RCSB PDB site
Description: Structure of coproheme decarboxylase from Listeria monocytogenes during turnover
Class: oxidoreductase
Keywords: coproheme decarboxylase, iron coproporphyrin III, monovinyl monopropionate deuteroheme, OXIDOREDUCTASE
Deposited on 2018-03-09, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fxqa_
  • Chain 'B':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fxqb_
  • Chain 'C':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fxqc_
  • Chain 'D':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fxqd_
  • Chain 'E':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fxqe_
  • Heterogens: FEC, VOV, NA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fxqA (A:)
    neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
    silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
    ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
    agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
    seqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxqA (A:)
    avktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysi
    lgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmaggdd
    pyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyag
    kvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllse
    qlsklfti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fxqB (B:)
    neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
    silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
    ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
    agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
    seqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxqB (B:)
    ktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysilg
    qkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsyqnkgvrarlypal
    ppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsigfddy
    ewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fxqC (C:)
    neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
    silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
    ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
    agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
    seqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxqC (C:)
    eavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiys
    ilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnyqnkgvrarl
    ypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsig
    fddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fxqD (D:)
    neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
    silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
    ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
    agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
    seqlsklfti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fxqE (E:)
    neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
    silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
    ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
    agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
    seqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxqE (E:)
    ktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysilg
    qkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnyyqnkgvrarlyp
    alppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsigfd
    dyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti