PDB entry 6fxj

View 6fxj on RCSB PDB site
Description: Structure of coproheme decarboxylase from Listeria monocytogenes in complex with iron coproporphyrin III
Class: oxidoreductase
Keywords: coproheme binding, coproheme decarboxylase, pentamer, oxidoreductase
Deposited on 2018-03-09, released 2019-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.7900000000000003 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fxja_
  • Chain 'B':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fxjb_
  • Chain 'C':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fxjc_
  • Chain 'D':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fxjd_
  • Chain 'E':
    Compound: Putative heme-dependent peroxidase lmo2113
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Gene: lmo2113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fxje_
  • Heterogens: FEC, NA, POL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fxjA (A:)
    mneavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehti
    ysilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmag
    gddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrs
    yagkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignll
    lseqlsklfti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fxjB (B:)
    mneavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehti
    ysilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmag
    gddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrs
    yagkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignll
    lseqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxjB (B:)
    eavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiys
    ilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelspyqnkgvrarl
    ypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsig
    fddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fxjC (C:)
    mneavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehti
    ysilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmag
    gddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrs
    yagkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignll
    lseqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxjC (C:)
    eavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiys
    ilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnyqnkgvrarl
    ypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsig
    fddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fxjD (D:)
    mneavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehti
    ysilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmag
    gddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrs
    yagkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignll
    lseqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxjD (D:)
    neavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiy
    silgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmagg
    ddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsy
    agkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlll
    seqlsklfti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fxjE (E:)
    mneavktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehti
    ysilgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnylashmag
    gddpyqnkgvrarlypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrs
    yagkvqqiiggsigfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignll
    lseqlsklfti
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxjE (E:)
    avktldgwfclhdfrsidwaawrelnpgnqelmlnelshflsdmeitknigegehtiysi
    lgqkadlvfftlrdslealnevenrfnklaiadyllptysyisvvelsnypyqnkgvrar
    lypalppkkhicfypmskkrdgadnwymlpmeerqqlirdhgligrsyagkvqqiiggsi
    gfddyewgvtlfsddalefkrivtemrfdeasaryaefgsffignlllseqlsklfti