PDB entry 6fxf

View 6fxf on RCSB PDB site
Description: crystal structure of the sam domain of murine sly1
Deposited on 2018-03-09, released 2019-01-30
The last revision was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAM and SH3 domain-containing protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: Sash3, Sly
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K352 (1-64)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fxfA (A:)
gpktlhellerigleehtstlllngyqtledfkelrethlnelnimdpqhraklltaael
lldyd