PDB entry 6fxa

View 6fxa on RCSB PDB site
Description: dimerization domain of tp901-1 ci repressor
Deposited on 2018-03-08, released 2018-05-30
The last revision was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ci
  Species: LACTOCOCCUS PHAGE TP901-1, synthetic [TaxId:35345]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O48503 (0-34)
• Chain 'B':
  Compound: ci
  Species: LACTOCOCCUS PHAGE TP901-1, synthetic [TaxId:35345]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O48503 (0-34)
• Chain 'C':
  Compound: ci
  Species: LACTOCOCCUS PHAGE TP901-1, synthetic [TaxId:35345]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O48503 (0-34)
• Chain 'D':
  Compound: ci
  Species: LACTOCOCCUS PHAGE TP901-1, synthetic [TaxId:35345]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O48503 (0-End)
• Chain 'E':
  Compound: ci
  Species: LACTOCOCCUS PHAGE TP901-1, synthetic [TaxId:35345]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O48503 (0-34)
• Chain 'F':
  Compound: ci
  Species: LACTOCOCCUS PHAGE TP901-1, synthetic [TaxId:35345]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O48503 (0-34)
• Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fxaA (A:)
  enieetitvmkkleeprqkvvldtakiqlkeqdeq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fxaB (B:)
  enieetitvmkkleeprqkvvldtakiqlkeqdeq
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fxaC (C:)
  enieetitvmkkleeprqkvvldtakiqlkeqdeq
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records:
  

  >6fxaD (D:)
  enieetitvmkkleeprqkvvldtakiqlkeqdeq
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6fxaD (D:)
  enieetitvmkkleeprqkvvldtakiqlkeqde
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fxaE (E:)
  enieetitvmkkleeprqkvvldtakiqlkeqdeq
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records:
  

  >6fxaF (F:)
  enieetitvmkkleeprqkvvldtakiqlkeqdeq