PDB entry 6fx7

View 6fx7 on RCSB PDB site
Description: Crystal structure of in vitro evolved Af1521
Class: signaling protein
Keywords: Macro domain, ADP-ribose binding, SIGNALING PROTEIN
Deposited on 2018-03-08, released 2019-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: [Protein ADP-ribosylglutamate] hydrolase AF_1521
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Gene: AF_1521
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28751 (23-214)
      • expression tag (21-22)
      • engineered mutation (37)
      • engineered mutation (57)
      • engineered mutation (96)
      • engineered mutation (119)
      • engineered mutation (125)
      • engineered mutation (127)
      • engineered mutation (132)
      • engineered mutation (167)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d6fx7a1, d6fx7a2
  • Heterogens: AR6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fx7A (A:)
    mghhhhhhhhhhssghiddddkhmevlfeakvgditlrlaqgditqypakaivnaanerl
    ehgggvayaiakacagdaglyteiskkamreqfgrdcidhgevvvtpamnleergikyvl
    htvgpvcggmwsgelkeklykaflgplekaeemgvesiafpavsagirgcdlekvvetfl
    eavkdfkgsavkevalviydrksaevalkvfersl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fx7A (A:)
    khmevlfeakvgditlrlaqgditqypakaivnaanerlehgggvayaiakacagdagly
    teiskkamreqfgrdcidhgevvvtpamnleergikyvlhtvgpvcggmwsgelkeklyk
    aflgplekaeemgvesiafpavsagirgcdlekvvetfleavkdfkgsavkevalviydr
    ksaevalkvfersl