PDB entry 6fx3

View 6fx3 on RCSB PDB site
Description: crystal structure of pholiota squarrosa lectin in complex with a dodecasaccharide
Deposited on 2018-03-08, released 2018-07-11
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FX3
  • Chain 'B':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FX3 (0-42)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fx3A (A:)
    gamapvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg
    

    Sequence, based on observed residues (ATOM records):
    >6fx3A (A:)
    mapvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfht
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6fx3B (B:)
    gamapvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg