PDB entry 6fwx

View 6fwx on RCSB PDB site
Description: Chimeric titin Z1Z2-Z1Z2 tandem (Z1212) functionalized with a GRGDS exogenous peptide from fibronectin
Class: structural protein
Keywords: titin, Z1Z2, STRUCTURAL PROTEIN
Deposited on 2018-03-07, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Titin,Titin,Titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwxa1, d6fwxa2
  • Chain 'B':
    Compound: Titin,Titin,Titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (Start-195)
    • Uniprot Q8WZ42 (196-241)
      • linker (242-248)
    • Uniprot Q8WZ42 (249-End)
    Domains in SCOPe 2.07: d6fwxb1, d6fwxb2
  • Heterogens: EDO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fwxA (A:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgettqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqv
    issgrgdsspgvqisfsdgrakltipavtkansgryslkatngsgqatstaellvkaeta
    ppnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlysll
    iaeaypedsgtysvnatnsvgratstaellvqge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwxA (A:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fwxB (B:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgettqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqv
    issgrgdsspgvqisfsdgrakltipavtkansgryslkatngsgqatstaellvkaeta
    ppnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlysll
    iaeaypedsgtysvnatnsvgratstaellvqge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwxB (B:)
    ppnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlysll
    iaeaypedsgtysvnatnsvgratstaellvqgettqaptftqplqsvvvlegstatfea
    hisgfpvpevswfrdgqvissgrgdsspgvqisfsdgrakltipavtkansgryslkatn
    gsgqatstaellvka