PDB entry 6fwu

View 6fwu on RCSB PDB site
Description: Crystal structure of human wild type beta-1,4-galactosyltransferase-1 (B4GalT1) in apo-closed dimeric form
Class: transferase
Keywords: Galactosyltransferase, beta-1, 4-galactosyltransferase I, B4GalT1, GalT1, glycosyltransferase, N-linked glycosylation, apo, monomer, monomeric, open conformation, TRANSFERASE
Deposited on 2018-03-07, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: B4GALT1, GGTB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fwua_
  • Chain 'B':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: B4GALT1, GGTB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fwub_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fwuA (A:)
    slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
    nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
    fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
    nywgwggedddifnrlvfrgmsisrpnavvgrcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltyqvldvqryplytqitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwuA (A:)
    slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
    nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
    fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
    nywgwggedddifnrlvfrgmsisrpnavvgrcrmirhsetmlsdglnsltyqvldvqry
    plytqitvdigtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fwuB (B:)
    slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
    nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
    fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
    nywgwggedddifnrlvfrgmsisrpnavvgrcrmirhsrdkknepnpqrfdriahtket
    mlsdglnsltyqvldvqryplytqitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwuB (B:)
    slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
    nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
    fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
    nywgwggedddifnrlvfrgmsisrpnavvgrcrmiretmlsdglnsltyqvldvqrypl
    ytqitvdigtp