PDB entry 6fwt

View 6fwt on RCSB PDB site
Description: Crystal structure of human wild type beta-1,4-galactosyltransferase-1 (B4GalT1) in apo-open monomeric form
Class: transferase
Keywords: Galactosyltransferase, beta-1, 4-galactosyltransferase I, B4GalT1, GalT1, glycosyltransferase, N-linked glycosylation, apo, monomer, monomeric, open conformation, TRANSFERASE
Deposited on 2018-03-07, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: B4GALT1, GGTB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwta_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fwtA (A:)
    ttalslpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaii
    ipfrnrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydy
    tcfvfsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltin
    gfpnnywgwggedddifnrlvfrgmsisrpnavvgrcrmirhsrdkknepnpqrfdriah
    tketmlsdglnsltyqvldvqryplytqitvdigtps