PDB entry 6fwn

View 6fwn on RCSB PDB site
Description: structure and dynamics of the platelet integrin-binding c4 domain of von willebrand factor
Deposited on 2018-03-06, released 2018-10-24
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VWF, F8VWF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275 (4-84)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fwnA (A:)
gsmasacevvtgsprgdsqsswksvgsqwaspenpclinecvrvkeevfiqqrnvscpql
evpvcpsgfqlscktsaccpscrce