PDB entry 6fwh

View 6fwh on RCSB PDB site
Description: Acanthamoeba IGPD in complex with R-C348 to 1.7A resolution
Class: lyase
Keywords: Inhibitor, Histidine biosynthesis, Acanthamoeba, LYASE
Deposited on 2018-03-06, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwha1, d6fwha2
  • Chain 'B':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhb1, d6fwhb2
  • Chain 'C':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhc1, d6fwhc2
  • Chain 'D':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhd1, d6fwhd2
  • Chain 'E':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhe1, d6fwhe2
  • Chain 'F':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhf1, d6fwhf2
  • Chain 'G':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhg1, d6fwhg2
  • Chain 'H':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhh1, d6fwhh2
  • Chain 'I':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhi1, d6fwhi2
  • Chain 'J':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhj1, d6fwhj2
  • Chain 'K':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhk1, d6fwhk2
  • Chain 'L':
    Compound: Imidazoleglycerol-phosphate dehydratase
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwhl1, d6fwhl2
  • Heterogens: MN, 5LD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fwhA (A:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhA (A:)
    ekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdl
    hvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidl
    klkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavt
    kdgpadavpstkgvle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fwhB (B:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhB (B:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fwhC (C:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhC (C:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fwhD (D:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhD (D:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fwhE (E:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhE (E:)
    reaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlhv
    ddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlkl
    krekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtkd
    gpadavpstkgvle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fwhF (F:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhF (F:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6fwhG (G:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhG (G:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6fwhH (H:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhH (H:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6fwhI (I:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhI (I:)
    reaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlhv
    ddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlkl
    krekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtkd
    gpadavpstkgvle
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6fwhJ (J:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhJ (J:)
    reaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlhv
    ddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlkl
    krekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtkd
    gpadavpstkgvle
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6fwhK (K:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhK (K:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fwhL (L:)
    mekreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagd
    lhvddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavid
    lklkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreav
    tkdgpadavpstkgvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwhL (L:)
    kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh
    vddhhtsedcaivlgqafrqaigerkgikrygsayapldeslaravvdissrpfavidlk
    lkrekigelscemiphvlhsfatsanltlhvevlygandhhkaesafkatalalreavtk
    dgpadavpstkgvle