PDB entry 6fwe

View 6fwe on RCSB PDB site
Description: Phosphotriesterase PTE_C23_6
Class: hydrolase
Keywords: Metalloenzyme, TIM barrel, hydrolase
Deposited on 2018-03-06, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • conflict (43)
      • conflict (46)
      • conflict (98)
      • conflict (139)
      • conflict (151)
      • conflict (220)
      • conflict (240)
      • conflict (285)
      • conflict (308)
    Domains in SCOPe 2.07: d6fwea_
  • Heterogens: FMT, ZN, E9E, E8N, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fweA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraa
    gvrtivdvstfdigrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflre
    iqygiedtgiragiikvatngkatpfqelvlraaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallg
    nrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvi
    pflrekgvsqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fweA (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
    qygiedtgiragiikvatngkatpfqelvlraaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
    flrekgvsqetlagitvtnparflsptlra