PDB entry 6fwb

View 6fwb on RCSB PDB site
Description: Crystal structure of Mat2A at 1.79 Angstron resolution
Class: hydrolase
Keywords: S-adenosylmethionine synthetase 2, HYDROLASE
Deposited on 2018-03-06, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-adenosylmethionine synthase isoform type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAT2A, AMS2, MATA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwba1, d6fwba2, d6fwba3
  • Chain 'B':
    Compound: S-adenosylmethionine synthase isoform type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAT2A, AMS2, MATA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwbb1, d6fwbb2, d6fwbb3
  • Chain 'C':
    Compound: S-adenosylmethionine synthase isoform type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAT2A, AMS2, MATA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwbc1, d6fwbc2, d6fwbc3
  • Chain 'D':
    Compound: S-adenosylmethionine synthase isoform type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAT2A, AMS2, MATA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fwbd1, d6fwbd2, d6fwbd3
  • Heterogens: SO4, PG4, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fwbA (A:)
    mahhhhhhenlyfqgsmngqlngfheafieegtflftsesvgeghpdkicdqisdavlda
    hlqqdpdakvacetvaktgmillageitsraavdyqkvvreavkhigyddsskgfdyktc
    nvlvaleqqspdiaqgvhldrneedigagdqglmfgyatdeteecmpltivlahklnakl
    aelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivisvqhdeevcldemrdalke
    kvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrkiivdtyggwgahgggafsg
    kdytkvdrsaayaarwvakslvkgglcrrvlvqvsyaigvshplsisifhygtsqksere
    lleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfpwevpkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwbA (A:)
    gtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsra
    avdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspeedigagdqglmfgyatdet
    eecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivis
    vqhdeevcldemrdalkekvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrki
    ivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglcrrvlvqvsyaigvsh
    plsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfp
    wevpkklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fwbB (B:)
    mahhhhhhenlyfqgsmngqlngfheafieegtflftsesvgeghpdkicdqisdavlda
    hlqqdpdakvacetvaktgmillageitsraavdyqkvvreavkhigyddsskgfdyktc
    nvlvaleqqspdiaqgvhldrneedigagdqglmfgyatdeteecmpltivlahklnakl
    aelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivisvqhdeevcldemrdalke
    kvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrkiivdtyggwgahgggafsg
    kdytkvdrsaayaarwvakslvkgglcrrvlvqvsyaigvshplsisifhygtsqksere
    lleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfpwevpkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwbB (B:)
    ieegtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageit
    sraavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspdneedigagdqglmfgy
    atdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymqdrgavlpirvh
    tivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlqpsgrfviggpqgdagl
    tgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglcrrvlvqvsya
    igvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiyqrtaayghfg
    rdsfpwevpkklk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fwbC (C:)
    mahhhhhhenlyfqgsmngqlngfheafieegtflftsesvgeghpdkicdqisdavlda
    hlqqdpdakvacetvaktgmillageitsraavdyqkvvreavkhigyddsskgfdyktc
    nvlvaleqqspdiaqgvhldrneedigagdqglmfgyatdeteecmpltivlahklnakl
    aelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivisvqhdeevcldemrdalke
    kvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrkiivdtyggwgahgggafsg
    kdytkvdrsaayaarwvakslvkgglcrrvlvqvsyaigvshplsisifhygtsqksere
    lleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfpwevpkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwbC (C:)
    egtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsr
    aavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspgagdqglmfgyatdeteec
    mpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivisvqh
    deevcldemrdalkekvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrkiivd
    tyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglcrrvlvqvsyaigvshpls
    isifhygtsqkserelleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfpwev
    pkkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fwbD (D:)
    mahhhhhhenlyfqgsmngqlngfheafieegtflftsesvgeghpdkicdqisdavlda
    hlqqdpdakvacetvaktgmillageitsraavdyqkvvreavkhigyddsskgfdyktc
    nvlvaleqqspdiaqgvhldrneedigagdqglmfgyatdeteecmpltivlahklnakl
    aelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivisvqhdeevcldemrdalke
    kvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrkiivdtyggwgahgggafsg
    kdytkvdrsaayaarwvakslvkgglcrrvlvqvsyaigvshplsisifhygtsqksere
    lleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfpwevpkklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fwbD (D:)
    egtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsr
    aavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqeedigagdqglmfgyatdete
    ecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivisv
    qhdeevcldemrdalkekvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrkii
    vdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglcrrvlvqvsyaigvshp
    lsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfpw
    evpkklk