PDB entry 6fw4

View 6fw4 on RCSB PDB site
Description: protein-protein interactions and conformational changes : importance of the hydrophobic cavity of tola c-terminal domain
Deposited on 2018-03-05, released 2019-03-20
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TolA protein
    Species: Vibrio cholerae [TaxId:666]
    Gene: ERS013140_01933
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fw4A (A:)
aarqqfvtsevgrygaiytqlirqnllvedsfrgkqcrvnlkliptgtgallgsltvldg
dsrlcaatkravaqvnsfplpkdqpdvveklkninltvape