PDB entry 6fvf

View 6fvf on RCSB PDB site
Description: The Structure of CK2alpha with CCh503 bound
Class: transferase
Keywords: CK2alpha, CK2a, fragment based drug discovery, high concentration screening, selective ATP competitive inhibitors, surface entrophy reduction, transferase
Deposited on 2018-03-02, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68400 (Start-327)
      • engineered mutation (19)
      • engineered mutation (72-74)
    Domains in SCOPe 2.07: d6fvfa_
  • Heterogens: 503, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fvfA (A:)
    sgpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvaaakikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fvfA (A:)
    gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
    ekvvvkilkpvaaakikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
    qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
    hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
    vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
    kllrydhqsrltareamehpyfytvvk