PDB entry 6fvc

View 6fvc on RCSB PDB site
Description: Protein environment affects the water-tryptophan binding mode. Molecular dynamics simulations of Engrailed homeodomain mutants
Class: DNA binding protein
Keywords: Engrailed Homeodomain, K52E mutation, DNA, DNA binding protein
Deposited on 2018-03-02, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Segmentation polarity homeobox protein engrailed
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: en, CG9015
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02836 (3-61)
      • expression tag (0-2)
      • engineered mutation (54)
      • expression tag (62-63)
    Domains in SCOPe 2.07: d6fvca1, d6fvca2, d6fvca3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fvcA (A:)
    gamekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnerakik
    ksgs