PDB entry 6fuz

View 6fuz on RCSB PDB site
Description: Crystal structure of the TPR domain of KLC1 in complex with the C-terminal peptide of JIP1
Class: motor protein
Keywords: Protein complex, MOTOR PROTEIN, nanobody, cargo recognition
Deposited on 2018-02-28, released 2018-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin light chain 1,Kinesin light chain 1,C-Jun-amino-terminal kinase-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK8IP1, IB1, JIP1, PRKM8IP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UE59
    • PDB 6FUZ (Start-336)
  • Chain 'N':
    Compound: Nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FUZ
    Domains in SCOPe 2.08: d6fuzn1, d6fuzn2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download) 
    >6fuzN (N:)
qvqlqesggglvqpggslrlscaasgfafssywmywvrqapekglewvstintgggityy
kdsvkgrftvsrdnakntlylqmnslkpedaaqyycatdmsgtyrgqgtqvtvsshhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >6fuzN (N:)
vqlqesggglvqpggslrlscaasgfafssywmywvrqapekglewvstintgggityyk
dsvkgrftvsrdnakntlylqmnslkpedaaqyycatdmsgtyrgqgtqvtv