PDB entry 6fux

View 6fux on RCSB PDB site
Description: Structure of aminoglycoside phosphotransferase APH(3'')-Id from Streptomyces rimosus ATCC10970 in complex with ADP and streptomycin
Class: transferase
Keywords: Streptomyces rimosus, aminoglycoside phosphotransferase, antibiotic resistance, streptomycin, phosphorylation, ATP binding, kinase activity, TRANSFERASE
Deposited on 2018-02-28, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside phosphotransferase
    Species: Streptomyces rimosus subsp. rimosus ATCC 10970 [TaxId:1265868]
    Gene: SRIM_08058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fuxa_
  • Heterogens: GOL, ADP, SRY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fuxA (A:)
    midltafltllradggdagwepvtdgesgaavfrsadgsryakcvpadqvaaleaerdrv
    swlstqdipgprvldwrvgaagaglltstvegipadrasasmlraawepiadavrrlhel
    ppekcpftrelgemfsmardvvareavnpdflpeeqrhtppgellarlapyvgqrlaqea
    aqtvvchgdlclpniildpdtldvagfidlgrlgradpyadlallfataretwgdderws
    qsaeeefaarygialdrdrerfylhldpltwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fuxA (A:)
    midltafltllradggdagwepvtaavfrsadgsryakcvpadqvaaleaerdrvswlst
    qdipgprvldwrvgaagaglltstvegipadrasasmlraawepiadavrrlhelppekc
    pftrelgemfsmardvvareavnpdflpeeqrhtppgellarlapyvgqrlaqeaaqtvv
    chgdlclpniildpdtldvagfidlgrlgradpyadlallfataretwgdderwsqsaee
    efaarygialdrdrerfylhldpltwg