PDB entry 6fur

View 6fur on RCSB PDB site
Description: F11 T-Cell Receptor Recognising PKYVKQNTLKLAT Peptide Presented by HLA-DR*0101
Class: immune system
Keywords: T Cell Receptor, Human Leukocyte Antigen, Influenza Epitope, Haemagglutinin, 3D Structure, IMMUNE SYSTEM
Deposited on 2018-02-27, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.7300000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human F11 T-Cell Receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FUR (0-201)
    Domains in SCOPe 2.08: d6fura1, d6fura2
  • Chain 'B':
    Compound: Human F11 T-Cell Receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FUR (0-239)
    Domains in SCOPe 2.08: d6furb1, d6furb2
  • Chain 'C':
    Compound: Human F11 T-Cell Receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FUR (0-201)
    Domains in SCOPe 2.08: d6furc1, d6furc2
  • Chain 'D':
    Compound: Human F11 T-Cell Receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FUR (0-239)
    Domains in SCOPe 2.08: d6furd1, d6furd2
  • Heterogens: EDO, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6furA (A:)
    aqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
    ngfeaefkksetsfhltkpsahmsdaaeyfcavseqddkiifgkgtrlhilpniqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6furB (B:)
    advtqtprnritktgkrimlecsqtkghdrmywyrqdpglglrliyysfdvkdinkgeis
    dgysvsrqaqakfslslesaipnqtalyfcatsdesygytfgsgtrltvvedlnkvsppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6furC (C:)
    aqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
    ngfeaefkksetsfhltkpsahmsdaaeyfcavseqddkiifgkgtrlhilpniqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffps
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6furD (D:)
    advtqtprnritktgkrimlecsqtkghdrmywyrqdpglglrliyysfdvkdinkgeis
    dgysvsrqaqakfslslesaipnqtalyfcatsdesygytfgsgtrltvvedlnkvsppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad