PDB entry 6fuj

View 6fuj on RCSB PDB site
Description: Complement factor D in complex with the inhibitor N-(3'-(aminomethyl)-[1,1'-biphenyl]-3-yl)-3-methylbutanamide
Class: hydrolase
Keywords: SERINE PROTEASE, inhibitor, complex, HYDROLASE
Deposited on 2018-02-27, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fuja_
  • Chain 'B':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fujb_
  • Chain 'C':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fujc_
  • Chain 'D':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fujd_
  • Chain 'E':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fuje_
  • Chain 'F':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fujf_
  • Heterogens: E8B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fujA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fujA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fujB (B:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fujB (B:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fujC (C:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fujC (C:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fujD (D:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fujD (D:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fujE (E:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fujE (E:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahclgkvqvllgahslsqpep
    skrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcdv
    agwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsckgdsgg
    plvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fujF (F:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fujF (F:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla