PDB entry 6fui

View 6fui on RCSB PDB site
Description: Complement factor D in complex with the inhibitor 3-((3-((3-(aminomethyl)phenyl)amino)-1H-pyrazolo[3,4-d]pyrimidin-4-yl)amino)phenol
Class: hydrolase
Keywords: SERINE PROTEASE, inhibitor, complex, HYDROLASE
Deposited on 2018-02-27, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Gene: CFD, DF, PFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fuia_
  • Heterogens: E7W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fuiA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvlasaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fuiA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvl