PDB entry 6fuf

View 6fuf on RCSB PDB site
Description: Crystal structure of the rhodopsin-mini-Go complex
Class: signaling protein
Keywords: GPCR Complex Rhodopsin, SIGNALING PROTEIN
Deposited on 2018-02-27, released 2018-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhodopsin
    Species: Bos taurus [TaxId:9913]
    Gene: RHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02699 (0-315)
      • engineered mutation (0)
      • engineered mutation (255)
      • engineered mutation (280)
    Domains in SCOPe 2.08: d6fufa_
  • Chain 'B':
    Compound: Guanine nucleotide-binding protein G(o) subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09471 (Start-213)
      • engineered mutation (24-25)
      • engineered mutation (96)
      • engineered mutation (99)
      • engineered mutation (109)
      • engineered mutation (191)
      • engineered mutation (194)
  • Heterogens: RET, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6fufA (A:)
cgtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltlyv
tvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlgg
eialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryipe
gmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqesa
ttqkaekevtrmviiyviaflicwlpyagvafyifthqgscfgpifmtipaffaktsavy
npviyimmnkqfrncm

  • Chain 'B':
    No sequence available.