PDB entry 6fuc

View 6fuc on RCSB PDB site
Description: Structure of aminoglycoside phosphotransferase APH(3'')-Id from Streptomyces rimosus ATCC10970
Class: transferase
Keywords: Streptomyces rimosus, aminoglycoside phosphotransferase, antibiotic resistance, streptomycin, phosphorylation, ATP binding, kinase activity, TRANSFERASE
Deposited on 2018-02-26, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.1700000000000002 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside phosphotransferase
    Species: Streptomyces rimosus [TaxId:1927]
    Gene: SRIM_08058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fuca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fucA (A:)
    midltafltllradggdagwepvtdgesgaavfrsadgsryakcvpadqvaaleaerdrv
    swlstqdipgprvldwrvgaagaglltstvegipadrasasmlraawepiadavrrlhel
    ppekcpftrelgemfsmardvvareavnpdflpeeqrhtppgellarlapyvgqrlaqea
    aqtvvchgdlclpniildpdtldvagfidlgrlgradpyadlallfataretwgdderws
    qsaeeefaarygialdrdrerfylhldpltwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fucA (A:)
    midltafltllradggdagwepvtesgaavfrsadgsryakcvpadqvaaleaerdrvsw
    lstqdipgprvldwrvgaagaglltstvegipadrasasmlraawepiadavrrlhelpp
    ekcpftrelgemfsmardvvareavnpdflpeeqrhtppgellarlapyvgqrlaqeaaq
    tvvchgdlclpniildpdtldvagfidlgrlgradpyadlallfataretwgdderwsqs
    aeeefaarygialdrdrerfylhldpltwg