PDB entry 6fub

View 6fub on RCSB PDB site
Description: complex of rice blast (magnaporthe oryzae) effector protein avr-pike with the hma domain of pikm-1 from rice (oryza sativa)
Deposited on 2018-02-26, released 2018-06-13
The last revision was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NBS-LRR class disease resistance protein
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: Pikm1-TS, Pi-km1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5UBC1 (2-80)
      • expression tag (0-1)
  • Chain 'B':
    Compound: avr-pik protein
    Species: MAGNAPORTHE ORYZAE [TaxId:318829]
    Gene: AVR-Pik
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4B8C2 (1-92)
      • initiating methionine (0)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fubA (A:)
gpggemqkivfkipmvddksrtkamslvastvgvhsvaiagdlrdqvvvvgdgidsinlv
salrkkvgpamflevsqvked

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6fubB (B:)
metgnkyiekraidlsrerdpnffdnpgipvpecfwfmfknnvrqdagtcysswkmdmkv
gpnwvhiksddncnlsgdfppgwivlgkkrpgf