PDB entry 6fu4

View 6fu4 on RCSB PDB site
Description: ligand binding domain (lbd) of the p. aeruginosa histamine receptor tlpq
Deposited on 2018-02-26, released 2018-05-16
The last revision was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable chemotaxis transducer
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA2654
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Probable chemotaxis transducer
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA2654
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Probable chemotaxis transducer
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA2654
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Probable chemotaxis transducer
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: PA2654
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HSM, PO4, GOL, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fu4A (A:)
    mgsshhhhhhssglvprgshqhssvlvksastqmldesarlrleargelqalriqryfmd
    afqygkgfsrqilflrdqaqkrfldaydlredltrqvrtalaanpevlglyvvfepnald
    gkdelfvdqpalgsndkgrfslywaqatpgqlesesmieseladtssgpsgaaynawytc
    pkesgqpcvldpyfdkvgerqllmtsiafpleldgkvigvmgldinlsnlqalseqgnre
    lydgvgqvgilspaglfagnsrdagllgknlakadpqhagellqllaagksrlfnenddl
    kvlqplqpipgakpwgvllevpksallgpalalerqlddmrregt
    

    Sequence, based on observed residues (ATOM records):
    >6fu4A (A:)
    qmldesarlrleargelqalriqryfmdafqygkgfsrqilflrdqaqkrfldaydlred
    ltrqvrtalaanpevlglyvvfepnaldgkdelfvdqpalgsndkgrfslywaqatpgql
    esesmieseladtssgpsgaaynawytcpkesgqpcvldpyfdkvgerqllmtsiafple
    ldgkvigvmgldinlsnlqalseqgnrelydgvgqvgilspaglfagnsrdagllgknla
    kadpqhagellqllaagksrlfnenddlkvlqplqpipgakpwgvllevpksallgp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fu4B (B:)
    mgsshhhhhhssglvprgshqhssvlvksastqmldesarlrleargelqalriqryfmd
    afqygkgfsrqilflrdqaqkrfldaydlredltrqvrtalaanpevlglyvvfepnald
    gkdelfvdqpalgsndkgrfslywaqatpgqlesesmieseladtssgpsgaaynawytc
    pkesgqpcvldpyfdkvgerqllmtsiafpleldgkvigvmgldinlsnlqalseqgnre
    lydgvgqvgilspaglfagnsrdagllgknlakadpqhagellqllaagksrlfnenddl
    kvlqplqpipgakpwgvllevpksallgpalalerqlddmrregt
    

    Sequence, based on observed residues (ATOM records):
    >6fu4B (B:)
    desarlrleargelqalriqryfmdafqygkgfsrqilflrdqaqkrfldaydlredltr
    qvrtalaanpevlglyvvfepnaldgkdelfvdqpalgsndkgrfslywaqatpgqlese
    smieseladtssgpsgaaynawytcpkesgqpcvldpyfdkvgerqllmtsiafpleldg
    kvigvmgldinlsnlqalseqgnrelydgvgqvgilspaglfagnsrdagllgknlakad
    pqhagellqllaagksrlfnenddlkvlqplqpipgakpwgvllevpksal
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6fu4C (C:)
    mgsshhhhhhssglvprgshqhssvlvksastqmldesarlrleargelqalriqryfmd
    afqygkgfsrqilflrdqaqkrfldaydlredltrqvrtalaanpevlglyvvfepnald
    gkdelfvdqpalgsndkgrfslywaqatpgqlesesmieseladtssgpsgaaynawytc
    pkesgqpcvldpyfdkvgerqllmtsiafpleldgkvigvmgldinlsnlqalseqgnre
    lydgvgqvgilspaglfagnsrdagllgknlakadpqhagellqllaagksrlfnenddl
    kvlqplqpipgakpwgvllevpksallgpalalerqlddmrregt
    

    Sequence, based on observed residues (ATOM records):
    >6fu4C (C:)
    qmldesarlrleargelqalriqryfmdafqygkgfsrqilflrdqaqkrfldaydlred
    ltrqvrtalaanpevlglyvvfepnaldgkdelfvdqpalgsndkgrfslywaqatpgql
    esesmieseladtssgpsgaaynawytcpkesgqpcvldpyfdkvgerqllmtsiafple
    ldgkvigvmgldinlsnlqalseqgnrelydgvgqvgilspaglfagnsrdagllgknla
    kadpqhagellqllaagksrlfnenddlkvlqplqpipgakpwgvllevpksallg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6fu4D (D:)
    mgsshhhhhhssglvprgshqhssvlvksastqmldesarlrleargelqalriqryfmd
    afqygkgfsrqilflrdqaqkrfldaydlredltrqvrtalaanpevlglyvvfepnald
    gkdelfvdqpalgsndkgrfslywaqatpgqlesesmieseladtssgpsgaaynawytc
    pkesgqpcvldpyfdkvgerqllmtsiafpleldgkvigvmgldinlsnlqalseqgnre
    lydgvgqvgilspaglfagnsrdagllgknlakadpqhagellqllaagksrlfnenddl
    kvlqplqpipgakpwgvllevpksallgpalalerqlddmrregt
    

    Sequence, based on observed residues (ATOM records):
    >6fu4D (D:)
    esarlrleargelqalriqryfmdafqygkgfsrqilflrdqaqkrfldaydlredltrq
    vrtalaanpevlglyvvfepnaldgkdelfvdqpalgsndkgrfslywaqatpgqleses
    mieseladtssgpsgaaynawytcpkesgqpcvldpyfdkvgerqllmtsiafpleldgk
    vigvmgldinlsnlqalseqgnrelydgvgqvgilspaglfagnsrdagllgknlakadp
    qhagellqllaagksrlfnenddlkvlqplqpipgakpwgvllevpksal