PDB entry 6ftw

View 6ftw on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 4D2 catalytic domain with inhibitor NPD-048
Class: hydrolase
Keywords: phosphodiesterase, hydrolase, cAMP hydrolysis, alternative splicing
Deposited on 2018-02-24, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ftwa_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: E6Z, ZN, MG, EDO, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ftwA (A:)
    gshmiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllkt
    fkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaai
    fasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltk
    kqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmv
    hcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfid
    yivhplwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqf
    eltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ftwA (A:)
    rfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvd
    tlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaih
    dvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqsl
    rkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadls
    nptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhpl
    wetwadlvhpdaqdildtlednrewyqstip
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.