PDB entry 6fts

View 6fts on RCSB PDB site
Description: tetr(d) n82a mutant in complex with peg4
Class: transcription
Keywords: transcription regulation, transcription
Deposited on 2018-02-23, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (1-206)
      • expression tag (0)
      • engineered mutation (80)
    Domains in SCOPe 2.07: d6ftsa1, d6ftsa2, d6ftsa3
  • Heterogens: PG4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ftsA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ftsA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnaamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv