PDB entry 6ftm

View 6ftm on RCSB PDB site
Description: Crystal structure of T. brucei PDE-B1 catalytic domain with inhibitor NPD-048
Class: hydrolase
Keywords: Parasitic phosphodiesterase, hydrolase, African trypanosomiasis, sleeping sickness
Deposited on 2018-02-22, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PDEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ftma_
  • Chain 'B':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: PDEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ftmb_
  • Heterogens: E6Z, MG, ZN, EDO, GAI, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ftmA (A:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ftmA (A:)
    vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
    gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
    alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
    gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
    vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
    fqkivdaclqgmqwtvdriksnraqwervletr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ftmB (B:)
    gshmaselnehratlfnknvpsravkrvtaitkvereavlvcelpsfdvtdvefdlfrar
    estdkpldvaaaiayrlllgsglpqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvc
    qtihtflyrgnvyekltelecfvllitalvhdldhmglnnsfylktesplgilssasgnt
    svlevhhcnlaveilsdpesdvfdglegaertlafrsmidcvlatdmakhgsaleaflas
    aadqssdeaafhrmtmeiilkagdisnvtkpfdisrqwamavteefyrqgdmekergvev
    lpmfdrsknmelakgqigfidfvaapffqkivdaclqgmqwtvdriksnraqwervletr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ftmB (B:)
    vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
    gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
    alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
    gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
    vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
    fqkivdaclqgmqwtvdriksnraqwervletr