PDB entry 6ftk

View 6ftk on RCSB PDB site
Description: gp36-mper
Deposited on 2018-02-22, released 2019-03-20
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Feline immunodeficiency virus [TaxId:11673]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0E8G2 (0-46)
      • engineered mutation (0)
      • engineered mutation (14)
      • expression tag (47-49)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ftkA (A:)
    lqtkdlqqkfyeiildieqnnvqgktgiqqlqkwedwvrwignipqylkm