PDB entry 6ftb

View 6ftb on RCSB PDB site
Description: staphylococcus aureus monofunctional glycosyltransferase in complex with moenomycin
Deposited on 2018-02-20, released 2018-06-27
The last revision was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monofunctional glycosyltransferase
    Species: Staphylococcus aureus MW2 [TaxId:1242971]
    Gene: mgt, MW1814
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A0I6 (9-209)
      • expression tag (0-8)
      • conflict (41)
  • Heterogens: M0E, EDO, PO4, 1QW, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ftbA (A:)
enlyfqghmdnvdelrkienkssfvsadnmpeyvkgafismqderfynhhgfdlkgttra
lfstisdrdvqggstitqqvvknyfydndrsftrkvkelfvahrvekqynkneilsfyln
niyfgdnqytlegaanhyfgttvnknsttmshitvlqsailaskvnapsvyninnmsenf
tqrvstnlekmkqqnyinetqyqqamsqln