PDB entry 6ft2

View 6ft2 on RCSB PDB site
Description: Structure of the periplasmic binding protein LAO-Q122A in complex with arginine.
Class: transport protein
Keywords: transport protein, periplasmic binding protein
Deposited on 2018-02-20, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine/arginine/ornithine-binding periplasmic protein
    Species: Salmonella typhimurium [TaxId:90371]
    Gene: argT, STM2355
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02911
      • engineered mutation (122)
    Domains in SCOPe 2.07: d6ft2a_
  • Heterogens: EDO, CL, ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ft2A (A:)
    malpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipsl
    kakkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqg
    staeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeya
    fagpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygdk
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ft2A (A:)
    lpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslka
    kkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgst
    aeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyafa
    gpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvyg