PDB entry 6ft1

View 6ft1 on RCSB PDB site
Description: Crystal structure of oxidised Flavodoxin 1 from Bacillus cereus (1.4 A resolution)
Class: electron transport
Keywords: flavodoxin, electron transfer, FMN, ELECTRON TRANSPORT
Deposited on 2018-02-20, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Bacillus cereus [TaxId:1396]
    Gene: ICO_01211
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ft1a_
  • Heterogens: FMN, SO4, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ft1A (A:)
    sklvmifasmsgnteemadhiagvireteneievidimdspeasileqydgiilgaytwg
    dgdlpddfldfydamdsidltgkkaavfgscdsaypkygvavdilieklqergaavvleg
    lkveltpededvekclqfgaefvkhls