PDB entry 6fsx

View 6fsx on RCSB PDB site
Description: The hit-and-return system enables efficient time-resolved serial synchrotron crystallography
Class: hydrolase
Keywords: halogenase, hydrolase
Deposited on 2018-02-20, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fsxa_
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fsxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fsxA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fsxA (A:)
    ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
    dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
    pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
    swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
    mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fsxB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fsxB (B:)
    dladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviv
    adlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlald
    spgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakl
    aswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipv
    pmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs