PDB entry 6fso

View 6fso on RCSB PDB site
Description: Crystal Structure of TGT in complex with methyl({[5-(pyridin-3-yloxy)furan-2-yl]methyl})amine
Class: transferase
Keywords: TGT, TRNA, GUANINE EXCHANGE ENZYME, PROTEIN INTERFACE, transferase
Deposited on 2018-02-20, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • conflict (302)
    Domains in SCOPe 2.07: d6fsoa_
  • Heterogens: ZN, PEG, DMS, F63, PG4, ACT, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fsoA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
    ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
    gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
    keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
    mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
    dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
    fsqfaqdfraryfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fsoA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmskqseegvtfkshldgsrhml
    spersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaen
    aalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddk
    phylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpld
    sechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaq
    dfraryfa