PDB entry 6fsi

View 6fsi on RCSB PDB site
Description: Crystal structure of semiquinone Flavodoxin 1 from Bacillus cereus (1.32 A resolution)
Class: electron transport
Keywords: flavodoxin, electron transfer, FMN, ELECTRON TRANSPORT
Deposited on 2018-02-19, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) [TaxId:226900]
    Gene: BC_1376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fsia_
  • Heterogens: FMN, SO4, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fsiA (A:)
    sklvmifasmsgnteemadhiagvireteneievidimdspeasileqydgiilgaytwg
    dgdlpddfldfydamdsidltgkkaavfgscdsaypkygvavdilieklqergaavvleg
    lkveltpededvekclqfgaefvkhls