PDB entry 6fsb

View 6fsb on RCSB PDB site
Description: Influenza B/Memphis/13/03 endonuclease with I38T mutation
Class: viral protein
Keywords: Influenza polymerase, endonuclease, VIRAL PROTEIN
Deposited on 2018-02-19, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: INFLUENZA B VIRUS (B/MEMPHIS/13/2003) [TaxId:1601067]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5V8Z9 (8-End)
      • expression tag (1-7)
      • engineered mutation (45)
      • conflict (67)
    Domains in SCOPe 2.07: d6fsba1, d6fsba2
  • Chain 'B':
    Compound: Polymerase acidic protein
    Species: INFLUENZA B VIRUS (B/MEMPHIS/13/2003) [TaxId:1601067]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5V8Z9 (8-204)
      • expression tag (0-7)
      • engineered mutation (45)
      • conflict (67)
    Domains in SCOPe 2.07: d6fsbb1, d6fsbb2
  • Heterogens: MN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fsbA (A:)
    gamgsgmamdtfitrnfqttiiqkakntmaefsedpelqpamlfntcvhlevcyvisdmn
    fldeegksytalegqgkeqnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfd
    yktkrfievgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvls
    rltelqaelslknlwqvligeedve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fsbA (A:)
    amgsgmamdtfitrnfqttiiqkakntmaefsedpelqpamlfntcvhlevcyvisdmnf
    ldeegksytalegqgkerpqyeviegmprtiawmvqrslaqehgietpkyladlfdyktk
    rfievgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvlsrlte
    lqaelslknlwqvligeedv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fsbB (B:)
    gamgsgmamdtfitrnfqttiiqkakntmaefsedpelqpamlfntcvhlevcyvisdmn
    fldeegksytalegqgkeqnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfd
    yktkrfievgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvls
    rltelqaelslknlwqvligeedve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fsbB (B:)
    gamgsgmamdtfitrnfqttiiqkakntmaefsedpelqpamlfntcvhlevcyvisdmn
    fldeegksytalegqgknlrpqyeviegmprtiawmvqrslaqehgietpkyladlfdyk
    tkrfievgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvlsrl
    telqaelslknlwqvligeedve