PDB entry 6fsa

View 6fsa on RCSB PDB site
Description: Beta-Cardiac myosin post-rigor
Class: motor protein
Keywords: Motor protein, myosin, hypertrophic cardiomyopathy
Deposited on 2018-02-19, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-7
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myosin-7
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Myosin light chain 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fsad_
  • Chain 'H':
    Compound: Myosin light chain 3
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fsah_
  • Heterogens: MG, ADP, FMT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fsaD (D:)
    mapkkpdpkkdeakagakaaaapapapapppapepskepefdpskikieftpeqieefke
    aftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvlgkpkqeelnskmmdfdtflp
    mlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhvlatlgekltedeveklmagq
    edsngcinyeafvkhimag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fsaD (D:)
    ikieftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvlgkpkq
    eelnskmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhvlatlg
    ekltedeveklmagqedsngcinyeafvkhimag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6fsaH (H:)
    mapkkpdpkkdeakagakaaaapapapapppapepskepefdpskikieftpeqieefke
    aftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvlgkpkqeelnskmmdfdtflp
    mlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhvlatlgekltedeveklmagq
    edsngcinyeafvkhimag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fsaH (H:)
    ftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlrvlgkpkqeeln
    skmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelrhvlatlgeklt
    edeveklmagqedsngcinyeafvkhimag