PDB entry 6fs9

View 6fs9 on RCSB PDB site
Description: Influenza B/Memphis/13/03 endonuclease with I38T mutation with bound inhibitor, baloxavir acid (BXA)
Class: viral protein
Keywords: Influenza polymerase, endonuclease, inhibitor, VIRAL PROTEIN
Deposited on 2018-02-19, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.2800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: INFLUENZA B VIRUS (B/MEMPHIS/13/2003) [TaxId:1601067]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5V8Z9 (8-End)
      • expression tag (6-7)
      • engineered mutation (45)
      • conflict (67)
    Domains in SCOPe 2.08: d6fs9a1, d6fs9a2
  • Heterogens: MN, E4Z, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fs9A (A:)
    gamgsgmamdtfitrnfqttiiqkakntmaefsedpelqpamlfntcvhlevcyvisdmn
    fldeegksytalegqgkeqnlrpqyeviegmprtiawmvqrslaqehgietpkyladlfd
    yktkrfievgitkgladdyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvls
    rltelqaelslknlwqvligeedve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs9A (A:)
    mamdtfitrnfqttiiqkakntmaefsedpelqpamlfntcvhlevcyvisdmnfldeeg
    ksytlrpqyeviegmprtiawmvqrslaqehgietpkyladlfdyktkrfievgitkgla
    ddyfwkkkeklgnsmelmifsynqdyslsnessldeegkgrvlsrltelqaelslknlwq
    vli