PDB entry 6fs4

View 6fs4 on RCSB PDB site
Description: nmr structure of casocidin-ii antimicrobial peptide in 60% tfe
Deposited on 2018-02-19, released 2018-10-03
The last revision was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-S2-casein
    Species: BOS TAURUS, synthetic [TaxId:9913]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fs4A (A:)
    tklteeeknrlnflkkisqryqkfalpqylk