PDB entry 6fs1

View 6fs1 on RCSB PDB site
Description: MCL1 in complex with an indole acid ligand
Class: immune system
Keywords: Mcl1, indole acid, immune system
Deposited on 2018-02-18, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MCL1, BCL2L3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07820 (2-149)
      • expression tag (0-1)
      • conflict (21)
      • conflict (24)
      • conflict (27)
      • conflict (29-30)
      • conflict (33-34)
      • conflict (36)
    Domains in SCOPe 2.08: d6fs1a1, d6fs1a2
  • Chain 'B':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MCL1, BCL2L3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07820 (2-149)
      • expression tag (0-1)
      • conflict (21)
      • conflict (24)
      • conflict (27)
      • conflict (29-30)
      • conflict (33-34)
      • conflict (36)
    Domains in SCOPe 2.08: d6fs1b1, d6fs1b2
  • Heterogens: E4Q, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fs1A (A:)
    ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
    lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
    esitdvlvrtkrdwlvkqrgwdgfveffhv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fs1B (B:)
    ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
    lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
    esitdvlvrtkrdwlvkqrgwdgfveffhv