PDB entry 6fs1
View 6fs1 on RCSB PDB site
Description: MCL1 in complex with an indole acid ligand
Class: immune system
Keywords: Mcl1, indole acid, immune system
Deposited on
2018-02-18, released
2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-12-26, with a file datestamp of
2018-12-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
Species: Homo sapiens [TaxId:9606]
Gene: MCL1, BCL2L3
Database cross-references and differences (RAF-indexed):
- Uniprot Q07820 (2-149)
- expression tag (0-1)
- conflict (21)
- conflict (24)
- conflict (27)
- conflict (29-30)
- conflict (33-34)
- conflict (36)
Domains in SCOPe 2.08: d6fs1a1, d6fs1a2 - Chain 'B':
Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
Species: Homo sapiens [TaxId:9606]
Gene: MCL1, BCL2L3
Database cross-references and differences (RAF-indexed):
- Uniprot Q07820 (2-149)
- expression tag (0-1)
- conflict (21)
- conflict (24)
- conflict (27)
- conflict (29-30)
- conflict (33-34)
- conflict (36)
Domains in SCOPe 2.08: d6fs1b1, d6fs1b2 - Heterogens: E4Q, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6fs1A (A:)
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6fs1B (B:)
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhv