PDB entry 6fs0

View 6fs0 on RCSB PDB site
Description: induced myeloid leukemia cell differentiation protein fabcomplex in complex with azd5991
Class: apoptosis
Keywords: mcl1-fab4460.55, apoptosis
Deposited on 2018-02-18, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Induced myeloid leukemia cell differentiation protein Mcl-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MCL1, BCL2L3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07820 (8-End)
      • expression tag (0-7)
      • conflict (27)
      • conflict (30)
      • conflict (33)
      • conflict (35-36)
      • conflict (39-40)
      • conflict (42)
    Domains in SCOPe 2.07: d6fs0a1, d6fs0a2
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FS0 (0-217)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FS0 (0-214)
    Domains in SCOPe 2.07: d6fs0l1, d6fs0l2
  • Heterogens: E4W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fs0A (A:)
    gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
    tafqgmlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqes
    cieplaesitdvlvrtkrdwlvkqrgwdgfveffhvedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs0A (A:)
    gplgseddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhe
    tafqgmlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqes
    cieplaesitdvlvrtkrdwlvkqrgwdgfveffhv
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fs0L (L:)
    svltqppsasgtpgqrvtiscsgsssnigsntvnwyqqlpgtapklliysnnqrpsgvpd
    rfsgsksgtsaslaisglqsedeadyycaawddslnawvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvthexxghtvekslsraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fs0L (L:)
    svltqppsasgtpgqrvtiscsgsssnigsntvnwyqqlpgtapklliysnnqrpsgvpd
    rfsgsksgtsaslaisglqsedeadyycaawddslnawvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsraa