PDB entry 6frz

View 6frz on RCSB PDB site
Description: Phosphotriesterase PTE_A53_7
Class: hydrolase
Keywords: Metalloenzyme, TIM barrel, hydrolase
Deposited on 2018-02-18, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • conflict (51)
      • conflict (54)
      • conflict (80)
      • conflict (106)
      • conflict (147)
      • conflict (159)
      • conflict (177)
      • conflict (228)
      • conflict (248)
      • conflict (293)
    Domains in SCOPe 2.07: d6frza_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (6-End)
      • expression tag (0-5)
      • conflict (6-7)
      • conflict (51)
      • conflict (54)
      • conflict (80)
      • conflict (106)
      • conflict (147)
      • conflict (159)
      • conflict (177)
      • conflict (228)
      • conflict (248)
      • conflict (293)
    Domains in SCOPe 2.07: d6frzb1, d6frzb2
  • Heterogens: FMT, ZN, E4T, TRS, P6G, PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6frzA (A:)
    isefitnsgdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavr
    glrraraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsvee
    ltqfflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfas
    qrdgeqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaigledn
    asasallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgm
    afiplrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frzA (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
    vrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
    qygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflspt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6frzB (B:)
    isefitnsgdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavr
    glrraraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsvee
    ltqfflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfas
    qrdgeqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaigledn
    asasallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgm
    afiplrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frzB (B:)
    isefitnsgdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavr
    glrraraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsvee
    ltqfflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfas
    qrdgeqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaigledn
    asasallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgm
    afiplrvipflrekgvpqetlagitvtnparflsptlra