PDB entry 6fry

View 6fry on RCSB PDB site
Description: Photo-Driven Hydrogen Evolution by an Artificial Hydrogenase Utilizing the Biotin-Streptavidin Technology
Class: oxidoreductase
Keywords: artificial metalloenzyme, hydrogenase, beta barrel, biotin-binding protein, oxidoreductase
Deposited on 2018-02-16, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (9-12)
      • conflict (120)
    Domains in SCOPe 2.07: d6frya1, d6frya2
  • Heterogens: 9CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fryA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    astlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fryA (A:)
    mgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgs
    gtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastlvghdt
    ftkvk