PDB entry 6frv

View 6frv on RCSB PDB site
Description: Structure of the catalytic domain of Aspergillus niger Glucoamylase
Class: hydrolase
Keywords: glycosylation, starch degradation, glycoside hydrolase, HYDROLASE
Deposited on 2018-02-16, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase
    Species: Aspergillus niger [TaxId:5061]
    Gene: GLAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6frva_
  • Heterogens: NAG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6frvA (A:)
    atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvl
    ktlvdlfrngdtsllstienyisaqaivqgisnpsgdlssgaglgepkfnvdetaytgsw
    grpqrdgpalratamigfgqwlldngytstatdivwplvrndlsyvaqywnqtgydlwee
    vngssfftiavqhralvegsafatavgsscswcdsqapeilcylqsfwtgsfilanfdss
    rsgkdantllgsihtfdpeaacddstfqpcspralanhkevvdsfrsiytlndglsdsea
    vavgrypedtyyngnpwflctlaaaeqlydalyqwdkqgslevtdvsldffkalysdaat
    gtyssssstyssivdavktfadgfvsivethaasngsmseqydksdgeqlsardltwsya
    alltannrrnsvvpaswgetsassvpgtcaatsaigtyssvtvtswpsivatggttttat
    ptgsgsvtstskttatasktststsstscttptavavtfdltatttygeniylvgsisql
    gdwetsdgialsadkytssdplwyvtvtlpagesfeykfiriesddsvewesdpnreytv
    pqacgtstatvtdtwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frvA (A:)
    atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvl
    ktlvdlfrngdtsllstienyisaqaivqgisnpsgdlssgaglgepkfnvdetaytgsw
    grpqrdgpalratamigfgqwlldngytstatdivwplvrndlsyvaqywnqtgydlwee
    vngssfftiavqhralvegsafatavgsscswcdsqapeilcylqsfwtgsfilanfdss
    rsgkdantllgsihtfdpeaacddstfqpcspralanhkevvdsfrsiytlndglsdsea
    vavgrypedtyyngnpwflctlaaaeqlydalyqwdkqgslevtdvsldffkalysdaat
    gtyssssstyssivdavktfadgfvsivethaasngsmseqydksdgeqlsardltwsya
    alltannrrnsvvpaswgetsassvpgtcaatsaigtyssvtvtswp