PDB entry 6frr
View 6frr on RCSB PDB site
Description: Structural and immunological properties of the allergen Art v 3
Class: allergen
Keywords: Art v 3.0201 lipid binding protein, ALLERGEN
Deposited on
2018-02-16, released
2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated
2019-03-13, with a file datestamp of
2019-03-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Non-specific lipid-transfer protein
Species: Artemisia vulgaris [TaxId:4220]
Gene: Art v 3
Database cross-references and differences (RAF-indexed):
- Uniprot C4MGG9 (2-91)
- initiating methionine (0)
- expression tag (1)
Domains in SCOPe 2.07: d6frra_ - Chain 'B':
Compound: Non-specific lipid-transfer protein
Species: Artemisia vulgaris [TaxId:4220]
Gene: Art v 3
Database cross-references and differences (RAF-indexed):
- Uniprot C4MGG9 (2-91)
- initiating methionine (0)
- expression tag (1)
Domains in SCOPe 2.07: d6frrb_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>6frrA (A:)
mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
dfksdfaaslpskcgvnipykisletdcnkvk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6frrB (B:)
mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
dfksdfaaslpskcgvnipykisletdcnkvk