PDB entry 6frr

View 6frr on RCSB PDB site
Description: Structural and immunological properties of the allergen Art v 3
Class: allergen
Keywords: Art v 3.0201 lipid binding protein, ALLERGEN
Deposited on 2018-02-16, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-specific lipid-transfer protein
    Species: Artemisia vulgaris [TaxId:4220]
    Gene: Art v 3
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4MGG9 (2-91)
      • initiating methionine (0)
      • expression tag (1)
    Domains in SCOPe 2.07: d6frra_
  • Chain 'B':
    Compound: Non-specific lipid-transfer protein
    Species: Artemisia vulgaris [TaxId:4220]
    Gene: Art v 3
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4MGG9 (2-91)
      • initiating methionine (0)
      • expression tag (1)
    Domains in SCOPe 2.07: d6frrb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6frrA (A:)
    mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
    dfksdfaaslpskcgvnipykisletdcnkvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6frrB (B:)
    mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
    dfksdfaaslpskcgvnipykisletdcnkvk