PDB entry 6frr

View 6frr on RCSB PDB site
Description: Structural and immunological properties of the allergen Art v 3
Class: allergen
Keywords: Art v 3.0201 lipid binding protein, ALLERGEN
Deposited on 2018-02-16, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-specific lipid-transfer protein
  Species: Artemisia vulgaris [TaxId:4220]
  Gene: Art v 3
  Database cross-references and differences (RAF-indexed):
  • Uniprot C4MGG9 (2-91)
    • initiating methionine (0)
    • expression tag (1)
  Domains in SCOPe 2.08: d6frra_
• Chain 'B':
  Compound: Non-specific lipid-transfer protein
  Species: Artemisia vulgaris [TaxId:4220]
  Gene: Art v 3
  Database cross-references and differences (RAF-indexed):
  • Uniprot C4MGG9 (2-91)
    • initiating methionine (0)
    • expression tag (1)
  Domains in SCOPe 2.08: d6frrb_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6frrA (A:)
  mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
  dfksdfaaslpskcgvnipykisletdcnkvk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6frrB (B:)
  mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
  dfksdfaaslpskcgvnipykisletdcnkvk