PDB entry 6frh

View 6frh on RCSB PDB site
Description: Crystal structure of Ssp DnaB Mini-Intein variant M86
Class: splicing
Keywords: intein, protein splicing, Hint domain fold, pre-splicing, SPLICING
Deposited on 2018-02-15, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicative DNA helicase,Replicative DNA helicase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: dnaB, slr0833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55418 (7-111)
      • initiating methionine (0)
      • expression tag (1-6)
      • engineered mutation (23)
      • engineered mutation (29)
      • engineered mutation (63)
      • conflict (23)
      • conflict (29)
      • conflict (63)
    • Uniprot Q55418 (112-164)
      • engineered mutation (112)
      • engineered mutation (127)
      • engineered mutation (147-148)
      • engineered mutation (159)
      • expression tag (165)
      • conflict (112)
      • conflict (127)
      • conflict (147-148)
      • conflict (159)
    Domains in SCOPe 2.07: d6frha1, d6frha2
  • Chain 'B':
    Compound: Replicative DNA helicase,Replicative DNA helicase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: dnaB, slr0833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55418 (7-End)
      • initiating methionine (0)
      • expression tag (1-6)
      • engineered mutation (23)
      • engineered mutation (29)
      • engineered mutation (63)
      • conflict (23)
      • conflict (29)
      • conflict (63)
    • Uniprot Q55418
      • engineered mutation (119)
      • engineered mutation (127)
      • engineered mutation (147-148)
      • engineered mutation (159)
      • conflict (119)
      • conflict (127)
      • conflict (147-148)
      • conflict (159)
    Domains in SCOPe 2.07: d6frhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6frhA (A:)
    mlresgaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkk
    lvytlktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlapeieklp
    qsdiywdpivsitetgveevfdltvpglrnfvandiivhasieqdklgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frhA (A:)
    mlresgaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkk
    lvytlktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlapesdiyw
    dpivsitetgveevfdltvpglrnfvandiivhasieqdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6frhB (B:)
    mlresgaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkk
    lvytlktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlapeieklp
    qsdiywdpivsitetgveevfdltvpglrnfvandiivhasieqdklgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frhB (B:)
    mlresgaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkk
    lvytlktrlgrtikatanhrfltidgwkrldelslkehialprklpqsdiywdpivsite
    tgveevfdltvpglrnfvandiivhasieq