PDB entry 6frg

View 6frg on RCSB PDB site
Description: Crystal structure of G-1F mutant of Ssp DnaB Mini-Intein variant M86
Class: splicing
Keywords: intein, protein splicing, Hint domain fold, pre-splicing form, SPLICING
Deposited on 2018-02-15, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicative DNA helicase
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: dnaB, slr0833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55418 (Start-111)
      • engineered mutation (5-6)
      • engineered mutation (23)
      • engineered mutation (29)
      • engineered mutation (63)
      • linker (112-116)
    • Uniprot Q55418 (117-End)
      • engineered mutation (119)
      • engineered mutation (127)
      • engineered mutation (147-148)
      • engineered mutation (159)
    Domains in SCOPe 2.07: d6frga_
  • Heterogens: 1PE, PGE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6frgA (A:)
    mlresfaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkk
    lvytlktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlapeieklp
    qsdiywdpivsitetgveevfdltvpglrnfvandiivhasieqdklgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frgA (A:)
    sfaisgdslislastgkrvpikdllgekdfeiwaineqtmklesakvsrvfctgkklvyt
    lktrlgrtikatanhrfltidgwkrldelslkehialprklessslqlapeieklpqsdi
    ywdpivsitetgveevfdltvpglrnfvandiivhasi