PDB entry 6frb

View 6frb on RCSB PDB site
Description: F11 T-Cell Receptor Recognising PKYVKQNTLKLAT Peptide Presented by HLA-DR*0101
Class: immune system
Keywords: T Cell Receptor, Human Leukocyte Antigen, Influenza Epitope, Haemagglutinin, 3D Structure, IMMUNE SYSTEM
Deposited on 2018-02-15, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human T-Cell Receptor F11 alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FRB (0-201)
    Domains in SCOPe 2.07: d6frba1, d6frba2
  • Chain 'B':
    Compound: Human T-Cell Receptor F11 beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FRB (0-239)
    Domains in SCOPe 2.07: d6frbb1, d6frbb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6frbA (A:)
    aqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
    ngfeaefkksetsfhltkpsahmsdaaeyfcavseqddkiifgkgtrlhilpniqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6frbB (B:)
    advtqtprnritktgkrimlecsqtkghdrmywyrqdpglglrliyysfdvkdinkgeis
    dgysvsrqaqakfslslesaipnqtalyfcatsdesygytfgsgtrltvvedlnkvsppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad