PDB entry 6fr5

View 6fr5 on RCSB PDB site
Description: HA1.7 TCR Study of CDR Loop Flexibility
Class: immune system
Keywords: 003 TCR, CDR Flexibility, Immune system, 3D Structure, MHC Class II
Deposited on 2018-02-15, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FR5 (0-201)
    Domains in SCOPe 2.07: d6fr5a1, d6fr5a2
  • Chain 'B':
    Compound: TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FR5 (0-243)
    Domains in SCOPe 2.07: d6fr5b1, d6fr5b2
  • Heterogens: EDO, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fr5A (A:)
    mkqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqts
    grlnasldkssgrstlyiaasqpgdsatylcavtnfnkfyfgsgtklnvkpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fr5B (B:)
    mkagvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgn
    fpgrfsgrqfsnsrsemnvstlelgdsalylcassfdsgnsplhfgngtrltvtedlnkv
    fppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeq
    palndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad